Dataset for protein Noxa of organism Laticauda laticaudata

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C5RIV9_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Laticauda laticaudata GN=PMAIP1 (length=52 residues).
MIVSSMQIGNTVLVCFTECSVAIALQLRRIGDKWNLRQRILNLFSKLFCPGT
© 1998-2022Legal notice