Dataset for protein Bim of organism Junco hyemalis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C5IZK3_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Junco hyemalis GN=BCL2L11 (length=169 residues).
MAKQPPEVKARRDGEGGRLPAAEGPGPGAQLRPGAPAALPGAGAVSAARGPPASPGPFATRSPLFIFVRRSPLLPRSSSG
YFSFEAERSPAPLSCDKATQTPSPPCQALSHCLSAMASRWQSHSPGEEVQPEIWIAQELRRIGDEFNASYCPRRVTFPSS
PPVSLEGEG
© 1998-2022Legal notice