Dataset for protein Bmf of organism Jaculus jaculus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C5K765_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Jaculus jaculus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDEEPGTQPGSLLSADLFAQSQMDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPTGLPLEEQPPEGQWPHRAEVQIARKLQCIADQFHRLHLQQHQQNRDRAW
WQVFLFLHNLALNREENRDGAGPR
>gnl|bcl2dbpro|A0A8C5K765_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Jaculus jaculus GN=BMF (length=189 residues).
IFPGEMEPPQCVEELEDDVFQPEDEEPGTQPGSLLSADLFAQSQMDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSP
ASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPTGLPLEEQPPEGQWPHRAEVQIARKLQCIADQFHRLHLQQHQQN
RDRAWWQVFLFLHNLALNREENRDGAGPR
© 1998-2022Legal notice