Dataset for protein Bad of organism Jaculus jaculus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C5P449_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Jaculus jaculus GN=BAD (length=201 residues).
MGTPKKPSLPPTEPQGVRKSEPGIRSLGSDAGGRRWRLAAQSMFQIPEFEPSEQEESSFSERGLGPSPTGPRQAPGLLGD
ISYRQRPQPSNSSHYGGGGALETRSRHSSYPAGTEEDGGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFK
GLPRPKSAGTATQMRQSSSWTRIIQSWWDRNLGRGGPAPSQ
© 1998-2022Legal notice