Dataset for protein Bmf of organism Ictalurus punctatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|W5UAU7_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Ictalurus punctatus GN=BMF (length=152 residues).
MDEDEDEVFGPISQCWPSSNREIKQEDHSTQTPGSPAVRLNGMLPCGVAEEPRRLFYGSAGLLLLTPSARTNRVEDAMFP
ENRPRRRPAHSVEAQIGQKLQMIGDQFYQEHMLQHQNQRNQWPFWLRLASALYALLFDGEPAVHRRRQEDRR
© 1998-2020Legal notice