Dataset for protein Bim of organism Ictalurus punctatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|W5UEE7_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Ictalurus punctatus GN=BCL2L11 (length=221 residues).
MLFARRRRFFFCPWSPEAVCPRNMSKRQYRADGPAFLKEHGGRGESASRAEPYESPQHRELEVIRGGIALPNSRVAYQSR
SPVFRTLSRSSSGYFSFDSEPSSPLITHSTATQTPSPSSQVITHALQRISKARGDAQNHELWPALLNHYPPHGAASAGDM
QAELEIARELRRIGDEFNQLYFHEAERNGGAARPQAQNEPAIMLWIGLLIGRLLQFFLRQR
© 1998-2020Legal notice