Dataset for protein Bad of organism Ictalurus punctatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2D0SYM2_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Ictalurus punctatus GN=BAD (length=198 residues).
MSNQYLLRLRKARFNFDKEEYTKVINTRIGSEGGGTILNHFFGNSSRITAFTMDETPQSVRGDAGPVDDKESRWSETVEN
TDSPSVGGRVRLYSESQVHTVSRWEDAELQDGISAEESGGASDGAPFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLD
RGDIRRVSSPGKVSQKQSNRGWFSFLWGSREEEEEGRE
© 1998-2020Legal notice