Dataset for protein Bmf of organism Homo sapiens

[Download (right click)] [Alignment] [Repertoires]

9 sequence(s)

>gnl|bcl2dbpro|Q96LC9_BMF-07 Bcl2 modifying factor protein OS=[Eukaryota] Homo sapiens GN=BMF (length=129 residues).
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSCVVADPPLPAQPCFEWRREQERGRP
>gnl|bcl2dbpro|Q96LC9_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Homo sapiens GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|Q96LC9_BMF-09 Bcl2 modifying factor protein OS=[Eukaryota] Homo sapiens GN=BMF (length=13 residues).
MEPSQCVEELEDD
>gnl|bcl2dbpro|Q96LC9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Homo sapiens GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|Q96LC9_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Homo sapiens GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|Q96LC9_BMF-08 Bcl2 modifying factor protein OS=[Eukaryota] Homo sapiens GN=BMF (length=61 residues).
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLR
>gnl|bcl2dbpro|Q96LC9_BMF-04 Bcl2 modifying factor protein OS=[Eukaryota] Homo sapiens GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|Q96LC9_BMF-05 Bcl2 modifying factor protein OS=[Eukaryota] Homo sapiens GN=BMF (length=129 residues).
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSCVVADPPLPAQPCFEWRREQERGRP
>gnl|bcl2dbpro|Q96LC9_BMF-06 Bcl2 modifying factor protein OS=[Eukaryota] Homo sapiens GN=BMF (length=163 residues).
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEHQQNQNRVWWQILLFLHNLALNGEENRNGA
GPR
© 1998-2020Legal notice