Dataset for protein Bmf of organism Gouania willdenowi

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C5HAH2_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Gouania willdenowi GN=BMF (length=162 residues).
MDDEEDDVFEPDPLCWRTAFKEIKCEDRVTQTPGPALVHSGMLPCGVAEEPRSLFHGNAGFRLHFPAHFELVGEHQSSPP
ESEEQRNTMEHLPRRPSVAHSVEARIGQKLQLIGDQFHREHLQRYHRNQRNNGPVWWRLAATLLGLLFDRGFIAGGGGAG
RR
© 1998-2022Legal notice