Dataset for protein Unclassified of organism Gopherus evgoodei

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C4YP80_uncHRK-01 Putative Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Gopherus evgoodei (length=87 residues).
MCPCALHGGPPAACPCSSARRGARFSGAQLVAARLKLVGDELQERTAWRRASSRRAAAGRSLATYLCLLCAASQVAALVW
LIRKRSW
© 1998-2022Legal notice