Dataset for protein Bmf of organism Gopherus evgoodei

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C4W1J6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Gopherus evgoodei GN=BMF (length=192 residues).
MDPPNYLEDDYSSLDGLDDDVFHSDFGLTGQPGEMTPPGIFTQNQSYSCLLGRFQLFPLTHCCGPGIRHAEQQDKATQTL
SPSSSTQDVMLPCGVTEEPQRLFYGNAGYRLHVPPVGFALNPHLQEEPREGQREALAEVQIARKLQCIADQFHRLHIQRH
QQNRNQVWWQILLFIHNLALNVEVNRNHVGQR
© 1998-2022Legal notice