Dataset for protein classical BH3-containing proteins of organism Gadus morhua

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C4ZU23_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Gadus morhua GN=BAD (length=155 residues).
MAASFSISDDESETSDELEGREFPLQVPNWHPAMRPPGGGRTRGNSESHVSYVDQEFRAGEGEDVGSGDGTPFRSRSQSA
PAALWAAKKYGRQLRRMSDEFDSWLDKGEMRKVKSAGSAGQMWLSRSWWSNLFSHQETEVENSAHHPENQSNRTE
© 1998-2022Legal notice