Dataset for protein Bik of organism Felis catus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A5F5XUY6_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Felis catus GN=BIK (length=245 residues).
MNLGVDTNTQSTANWGKANCKISRQENSCVVLPLGWSVLSRKGHKRKSPHGLFSKRGIRGPEGLRNLSGAKRPSWTRTQV
AQQPSAPWHSVPVHREEMSHAGPLSRNVFLSTFLQEHGPEVLDVPGMTDLVEYYDPGPSPNSNSPDDVAMRLAFIGDEME
VRWMMPRVGELPGMAVYSLAFTYNQTGLRGVLRSLMDGLANLRENIWIWGFLTLRNRVSPNSGRGLALSLLLLVLLLGWG
LHLLQ
© 1998-2020Legal notice