Dataset for protein Bmf of organism Erpetoichthys calabaricus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C4SHZ6_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Erpetoichthys calabaricus GN=BMF (length=204 residues).
MVAEVEVTLNIDPFVLFDRLPLRSRIRMDPEEDIEDDVFHPPELDRYPHTISGTFRHCSTSPRANPFFICQRFREVKYVD
QSTQTTSNHVPSYSSMLPYGVQEEPSYLFYGTAAHRLHFPAHFEVDRDGDTEEGMAEEEQEPGLSAEAQIGQKLQRIGDQ
FHRDYTQMLQQNQRNPQPLWWRMAVTLLAFLFDRDAGPNRMDAR
>gnl|bcl2dbpro|A0A8C4SHZ6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Erpetoichthys calabaricus GN=BMF (length=177 residues).
MDPEEDIEDDVFHPPELDRYPHTISGTFRHCSTSPRANPFFICQRFREVKYVDQSTQTTSNHVPSYSSMLPYGVQEEPSY
LFYGTAAHRLHFPAHFEVDRDGDTEEGMAEEEQEPGLSAEAQIGQKLQRIGDQFHRDYTQMLQQNQRNPQPLWWRMAVTL
LAFLFDRDAGPNRMDAR
© 1998-2022Legal notice