Dataset for protein Bik of organism Equus caballus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3Q2LHE3_BIK-02 BCL2-interacting killer protein OS=[Eukaryota] Equus caballus GN=BIK (length=226 residues).
MRKRRRHAAAKRQTWDSNSGPLVSEPRSSSSYSVPKAVWSSVGEEMSQVGPVSRDLFLDAFLHERSPEALEVPGMTELTE
SSPDSDNRDSVAMRLAFIGDEMEVRWMLPHIAELPGVAVYSLAFTYNQTGLRGVFRSFMDGLTNLRENIRFWSFLTRRDR
VSLRFHDLDSPSCMCSPLEPWSSCPVGHSLAGCHSPHQSLLSSFACFTHSSSCLFPGPLGLRWLAY
>gnl|bcl2dbpro|A0A3Q2LHE3_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Equus caballus GN=BIK (length=181 residues).
MSQVGPVSRDLFLDAFLHERSPEALEVPGMTELTESSPDSDNRDSVAMRLAFIGDEMEVRWMLPHIAELPGVAVYSLAFT
YNQTGLRGVFRSFMDGLTNLRENIRFWSFLTRRDRVSLRFHDLDSPSCMCSPLEPWSSCPVGHSLAGCHSPHQSLLSSFA
CFTHSSSCLFPGPLGLRWLAY
© 1998-2020Legal notice