Dataset for protein Noxa of organism Electrophorus electricus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A4W4H0G9_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Electrophorus electricus GN=PMAIP1 (length=71 residues).
KQAGTSPVTPCQLISWLSDLFLEQTVVSECACQLRRMGDLINWKYLLLHLIADARTRLGICSGNDVVALCM
© 1998-2020Legal notice