Dataset for protein Bmf of organism Electrophorus electricus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A4W4DZH9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Electrophorus electricus GN=BMF (length=156 residues).
MDDEEDDVFRIAAQYWPHSLREIKQEERGTQTAGRPLARPNGMLPCGVSEEPRRLFYGSAGLLLLAPPARPNSADDAMLP
ENQLAVEPPRRRPLHSVEASIGQKLQMIGDQFYQEHMLQHRNQRNHQPFWLRLASALYVLLFEREPAARWRGVDQR
© 1998-2020Legal notice