Dataset for protein Bad of organism Echeneis naucrates

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A665TUH3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Echeneis naucrates GN=BAD (length=162 residues).
MSAQFTISDSESDPSEEVEEGDMSQSLEQEVFQRHNLTLPEIRTAGAGRTRLNSESHTSTGSRDEDFLARGDDEAGTPTD
GAPFRGRSKSAPPALWAAKKYGQKLRRMSDEFDSLLDKGEMRKVKSVGSAKQMHHSKSWWNYLFSHQETEGENNHLESHR
NE
© 1998-2020Legal notice