Dataset for protein Unclassified of organism Denticeps clupeoides

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C3ZMC5_uncBAD-01 Putative BCL2-associated agonist of cell death protein OS=[Eukaryota] Denticeps clupeoides (length=141 residues).
MNDISSQLSTDAKPWQEPDLVLHQDGAPPAKTHPGGGRVRLYSESQVYTISRWEDSEPSDGGPAAEEGTGGGFRVRSQSA
PAALLAAKRYGSQLRRMSDEFDDWLDRGDQKRASSPGQLVLQASRRWLSFLWGPREEEGRE
© 1998-2022Legal notice