Dataset for protein Noxa of organism Delphinapterus leucas

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2Y9P485_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Delphinapterus leucas GN=PMAIP1 (length=54 residues).
MPGRRVRKSAQQSPTRAPADPEVECAIQFRRIGDKLNFRQKLLNLISKLFRSGT
© 1998-2020Legal notice