Dataset for protein Hrk of organism Delphinapterus leucas

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2Y9Q8G3_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Delphinapterus leucas GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPSALPTYWPWLCAAAQVAA
LAAWLLGRRNL
© 1998-2020Legal notice