Dataset for protein Bad of organism Danio rerio

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A7MCM4_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Danio rerio GN=BAD (length=147 residues).
MAHMFNISDDSETETMEDSEASSLDKHKSGSAQKKQHLTVPDRLKGEQLGRQRNLSMNEEDLLETGVAEDPHMLGDPFRP
RSRSAPPALWAAKKYGQQLRRMSDEFDKGQMKRVKSAGTARQMSQSPSWLAFLWSHKESDAESRPAE
© 1998-2022Legal notice