Dataset for protein Unclassified of organism Cyprinus carpio

[Download (right click)]

12 sequence(s)

>gnl|bcl2dbpro|A0A8C1K2C2_uncBCL2L11-02 Putative BCL2-like 11 protein OS=[Eukaryota] Cyprinus carpio (length=178 residues).
LADVSFCQTPGNGPASRGSGESAGGGAASRSGHFDFPQPSDGDPLRGGISMSNSHQSRSPMCRTFSRSSSGYFSVDSDSV
PGSPLMPNISEAQDGQNDELWFAEPSHQPAQMAAPVGAMGPEMAVARELRRIGDEFNRLYCQGDGNNGAQLRAPNEHAII
MWMNDLIGRVVQFFLRRR
>gnl|bcl2dbpro|A0A8C1K2C2_uncBCL2L11-01 Putative BCL2-like 11 protein OS=[Eukaryota] Cyprinus carpio (length=178 residues).
MSDTSREQTPGNGPASRGSGESAGGGAASRSGHFDFPQPSDGDPLRGGISMSNSHQSRSPMCRTFSRSSSGYFSVDSDSV
PGSPLMPNISEAQDGQNDELWFAEPSHQPAQMAAPVGAMGPEMAVARELRRIGDEFNRLYCQGDGNNGAQLRAPNEHAII
MWMNDLIGRVVQFFLRRR
>gnl|bcl2dbpro|A0A8C1K2C2_uncBCL2L11-03 Putative BCL2-like 11 protein OS=[Eukaryota] Cyprinus carpio (length=94 residues).
LFDTKYISMKNKIFFLWFAEPSHQPAQMAAPVGAMGPEMAVARELRRIGDEFNRLYCQGDGNNGAQLRAPNEHAIIMWMN
DLIGRVVQFFLRRR
>gnl|bcl2dbpro|A0A8C1KDX2_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Cyprinus carpio (length=236 residues).
MDDEEDEQLPHCCETPLRNKSSENRDGRSGEVGKTANRHGRFKDRSTQTASSVLNSARDGDMAPFQGLERDASPPCRSVD
ARTAFGANCGTGGLASLTIAPGAPEGPRALFHGNAGFRAHFPALFEPVLDGTQNAEEDEGRPEEKEEERDMGISVEIQIG
RKLREMGDQFQQDHLQLVRVISDEKSLFLFLKADLNQTGLNRTTSPWFLSRCAVTSSSVQCCICKCSVGEMTSLLV
>gnl|bcl2dbpro|A0A8C1M381_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Cyprinus carpio (length=111 residues).
MDEDEDDVHRKGLQHWPSSQVQIKQTDTAGRAPVSPDSMLPCRVHVEPRRFLYGNAGLLLLASLSRSRPPHVVLRQNLRM
MDPEESVETLIGQKLHYQDNLSHSVELDVLK
>gnl|bcl2dbpro|A0A8C1QJR9_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Cyprinus carpio (length=238 residues).
MDDEEDEQLPHCCETPLRNKSSENRDGPRGEVGQTANRHGRFEDRSTQTARTVLNSARDRDMAPFQGLERDASSPCRAVE
ARTAFGANCGTGGLASLTMAPGAPEGPRALFHGNAGFRSHFPALFEPVPDGTQNTEEDEGRPEEKEDERDVGISVEIQIG
RKLREMGDQFQLEHLQLVRVISDETRPILWFSLQWFLSRCAMTSSSVISMLHMQMLIGRDDIIFGLPELYGVFVVVKN
>gnl|bcl2dbpro|A0A8C1TKB8_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Cyprinus carpio (length=218 residues).
MDDEEDEQLPHCCETPLRNKSSENRDGRSGEVGKTANRHGRFKDRSTQTASSVLNSARDRDMAPFQGLERDASSPCRSVD
ARTAFGANCGTGGLASLTIAPGAPEGPRALFHGNAGFRAHFPALFEPVLDGTQNAEEDEGRPEEKEEERDVGISVEIQIG
RKLREMGDQFQQDHLQLVRVISDQKSFPWFLSRCAVTSSSVQCCICKCSVGEMTSLLV
>gnl|bcl2dbpro|A0A8C2BTF4_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Cyprinus carpio (length=238 residues).
MDDEEDEQLPHCCETPLRNKSSENRDGPRVEVGQTANRHGRFEDRSTQTARTVLNSARDRDMAPFQGLARDASSPCRSVD
ARTAFGANCGTGGLASLTIAPGAPEGPRALFHGNAGFRSHFPALFEPVPDGTQNTEEDEGRPEEKEDERDVGISVEIQIG
RKLREMGDQFQLEHLQLVRVISDETRPILWFSLQWFLSRCAMTSSSVISMLHMQMLIGRDDIIFGLPELYGVFVVVKN
>gnl|bcl2dbpro|A0A8C2F9E7_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Cyprinus carpio (length=218 residues).
MDDEEDEQLPHCCETPLRNKSSENRDGRSGEVGKTANRHGRFKDRSTQTASSVLNSARDRDMAPFQGLARDASSPCRSVD
ARTAFGANCGTGGLASLTIAPGAPEGPRALFHGNAGFRAHFPALFEPVLDGTQNAEEDEGRPEEKEEERDVGISVEIQIG
RKLREMGDQFQQDHLQLVRVISDEKSFPWFLSRCAVTSSSVQCCICKCSVGEMTSLLV
>gnl|bcl2dbpro|A0A8C2IKZ4_uncBCL2L11-01 Putative BCL2-like 11 protein OS=[Eukaryota] Cyprinus carpio (length=181 residues).
MSDTSREQTLANGPASRGGGESAGGGAVLRTEHFDFPQPSEGDSLRGGISMSNSHQSRSPMSRTFSRSSSGYFSVDSDSV
PSSPLMPNISEAQDDQNDEVWFDEPSHQHVQMAAPVGAMGPEMAVARELRRIGDEFNRLYCQGAGAGGNNAVQLHAPNEH
AIIIWMNDLIGRVVQFFLRRR
>gnl|bcl2dbpro|A0A8C2IKZ4_uncBCL2L11-02 Putative BCL2-like 11 protein OS=[Eukaryota] Cyprinus carpio (length=181 residues).
DSDTAREQTLANGPASRGGGESAGGGAVLRTEHFDFPQPSEGDSLRGGISMSNSHQSRSPMSRTFSRSSSGYFSVDSDSV
PSSPLMPNISEAQDDQNDEVWFDEPSHQHVQMAAPVGAMGPEMAVARELRRIGDEFNRLYCQGAGAGGNNAVQLHAPNEH
AIIIWMNDLIGRVVQFFLRRR
>gnl|bcl2dbpro|A0A8C2IKZ4_uncBCL2L11-03 Putative BCL2-like 11 protein OS=[Eukaryota] Cyprinus carpio (length=170 residues).
MSDTSREQTLANGPASRGGGESAGGGAVLRTEHFDFPQPSEGDSLRGGISMSNSHQSRSPMSRTFSRSSSGYFSVDSDSV
PSSPLMPNISEAQDDQNDEVWFDEPSHQHVRLIRLCESCSKRSNLHFLSVNIRLFTMYFEACACTCMSLQPGSFTISCKP
GAPETHDHSV
© 1998-2022Legal notice