Dataset for protein Noxa of organism Cyprinus carpio

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C1Q8B2_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Cyprinus carpio GN=PMAIP1 (length=72 residues).
MLITSLYLTPRLLTILHRSAFVAVRRSQQPPLQAAVVECAQELRRVGDLLNWKYRLLELIIKLRKLQTDGKS
© 1998-2022Legal notice