Dataset for protein Unclassified of organism Cyclopterus lumpus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C2Z4T8_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Cyclopterus lumpus (length=118 residues).
MDDEEDDVFEPDPNCWRTAFREIKCEDRGNAGFRLHFPANFELVGDQEARRQESEVEQNGMEQLPRQQPEAHSVEACIGQ
KLQLIGDQFHREHLQTGEDEICILVLWRQVAWRMPGLK
© 1998-2022Legal notice