Dataset for protein Bad of organism Cyclopterus lumpus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C3AQA3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cyclopterus lumpus GN=BAD (length=164 residues).
MAAHFTISDSESEPSEEVEEGENNQLSSMVEQQLRQRHSLTLPQLRLPATGRIRLNSESHASTVSRDEELWTDEAGTPTD
GAPFRVRSKSAPPALWAAKKYGRQLRRMSDEFDILLDKGEMRRVKSAGTAKQMHHSKSWWSYLFSHQEIEGENNHHENHT
HRTE
© 1998-2022Legal notice