Dataset for protein Noxa of organism Cyanistes caeruleus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C0UP29_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Cyanistes caeruleus GN=PMAIP1 (length=87 residues).
ITKVACGGDVISAVTTRGSAGREAAVAECALELSRIGDRWHLRQRILNVIAKLFCPETWAARGDGERNGRGPWFCGFGRR
GSTDSGR
© 1998-2022Legal notice