Dataset for protein Bmf of organism Cyanistes caeruleus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C0U4T1_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Cyanistes caeruleus GN=BMF (length=204 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGFFTQNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGSAGYRLHVPPAGFVLDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQR
LLLFSILLTTSTFSSVEHAAISGLCQLLILEITSLESVLTLLVV
© 1998-2022Legal notice