Dataset for protein Bim of organism Cyanistes caeruleus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C0UNY9_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Cyanistes caeruleus GN=BCL2L11 (length=101 residues).
XXXXXXXGGREGGREGGRMEPASFTGGRRSARGRPSRWQSQSAAEEVQPEIWIAQELRRIGDEFNASYCPRRGFLDQQVG
NPQVVILRLLRYIIRLIWRLQ
© 1998-2022Legal notice