Dataset for protein Bik of organism Cricetulus griseus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C2QMK2_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Cricetulus griseus GN=BIK (length=151 residues).
MSEARLMARDLIIKTVLHDQVPRPPVAPGAPSMKDSMRDLDLVECLENRNQVALRLAYIGDEMDLCLRGPRLAQLPGIAM
HRLAVNYSQTGARGIFRSLIRGLTNLREKIWSWRVLTPGTWVSPDQARGQLFPMVLLVLLLLGEALHLQLQ
© 1998-2022Legal notice