Dataset for protein Puma of organism Cricetulus griseus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C2MKP2_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Cricetulus griseus GN=BBC3 (length=175 residues).
MPPHPEVWPHCGWAGASCWRPGSSDWVGSVAVSPRDLGPFSGCVGVGGGPQFPCACQPKQALDLTASQKRGYLGPQPSLS
PAQQHLESPVPSAPEALAGGPTQAAPGVRGEEDEWAREIGAQLRRMADDLNAQYERRRQEDQHRHRPSPWRVMYNLFMGL
LPLPRDPGAPEMEPN
© 1998-2022Legal notice