Dataset for protein Unclassified of organism Coregonus sp balchen

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A6F9BUT0_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Coregonus sp. 'balchen' (length=194 residues).
MNIFDRLTGRRPLRLLMDDEEEDMSLQRRPVSQCWGTPFRDIKFHDRDGRDRGDTQDRSTQTSTGPNAIVPRSEGHNIMA
PQGHNNNNTLPCGLGSSPWTTGERGRTGREEGRRRRRRRRGRRRRMEERPEEERAEDSAEARIGRKLREIGDQFHQDHVQ
LVRVKVWMRLTMALYGFLFNREAPAVPHLRGQER
© 1998-2020Legal notice