Dataset for protein Bmf of organism Chinchilla lanigera

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C2VBL6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Chinchilla lanigera GN=BMF (length=259 residues).
MPRAGVFWKQYRAVCPGLLRARPPRRPPPAALGFPLLPHRVWAPSPRVLVTLDPGAEPWHHDSEADSLSWSHPGEMEPPQ
CVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLGRLHLFPLTHCCGPGLRPTSQEDKATQTLSPSSPSQGVMLP
CGVTEEPQRLFYGNAGYRLPLPASFPAGLPLEEQPPEGQWQHRAEVQIARKLRCIADQFHRLHMQQRQQNQNRVWWQVLL
FLHNLGLNGEENREGVGPR
© 1998-2022Legal notice