Dataset for protein Noxa of organism Chelydra serpentina

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C3RPK7_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Chelydra serpentina GN=PMAIP1 (length=58 residues).
SVDKKVYGIHKADDWFSFVFTAQEAVTQCSLQLRKIGDICNLQQKILNVITKLFCPGT
© 1998-2022Legal notice