Dataset for protein Bad of organism Chelydra serpentina

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C3S2L3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Chelydra serpentina GN=BAD (length=154 residues).
MFRIQEFPDEVFPGRGKESPAPPESQRGHTPGSKQPGTPTAEVRSRIGSDPPSLEPEVQDEPGGAFRARSRSAPPILWAA
MRYGRELRRMSDEFDVALQVLPRPKSAGTTSQLHWGNSWKETLQAWLGHRPARDAPAGAPSDCSLPAGGMGPAP
© 1998-2022Legal notice