Dataset for protein Unclassified of organism Chelonoidis abingdonii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C0G546_uncHRK-01 Putative Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Chelonoidis abingdonii (length=85 residues).
HCTCPLKPAALPASSSAGHGARFSGAQLVAARLKLVGDELQERTAWRRASSRRAAAGRSLATYLCLLCAASQVAALVWLI
RKRSW
© 1998-2022Legal notice