Dataset for protein Bim of organism Chelonoidis abingdonii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C0QRC8_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Chelonoidis abingdonii GN=BCL2L11 (length=183 residues).
MAKQPSDLNSECNREGGQFQSTERPSQPQHLRPGAPTSIQTQYQGNHSGEGDFAQQPSGSSSPSSPQGPFAPPSSPSPFA
TRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRWESSSIREDMQPEIWIAQEL
RRIGDEFNASYCPRRVTLFYFIF
© 1998-2022Legal notice