Dataset for protein Bad of organism Chelonoidis abingdonii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C0IJG1_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Chelonoidis abingdonii GN=BAD (length=141 residues).
MFRIQEFPDEVFPGRGKEAPAPPESQRGHTPGSKQPDTPIAEVRNRIGSDTPSLEPEVQDEPGGAFRARSRSAPPILWAA
MRYGRELRRMSDEFDVALQVLPRPKSAGTTSQLHQGNSWKETLQAWLGHRPARDALPRSSK
© 1998-2022Legal notice