Dataset for protein Hrk of organism Cebus imitator

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2K5PIE7_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Cebus imitator GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPSALPTYWPWLCAAAQVAA
LAAWLLGRRNL
© 1998-2021Legal notice