Dataset for protein Bad of organism Catharus ustulatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C3UF02_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Catharus ustulatus GN=BAD (length=94 residues).
GEEGGGGAGGGAGGGAGGGAGDPPAHRGRSRSAPPVLWAAQRYGRRLRRMSDEFQLQVLPRPRSVGGAPPWGRGWRETLR
AWWGRRPSPPAPPP
© 1998-2023Legal notice