Dataset for protein Bmf of organism Catagonus wagneri

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C3WX89_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Catagonus wagneri GN=BMF (length=183 residues).
MEPPQCVEELEDDVFQPEEGEPGTQPRRVSADPFVQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQG
VMLPCGVTEEPQRLFYGNAGYRLPLPAGFPTGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVWW
QVLLFLHNLALHGDENRNGAGPR
© 1998-2022Legal notice