Dataset for protein Bad of organism Catagonus wagneri

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C3X9L5_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Catagonus wagneri GN=BAD (length=167 residues).
MFQIPEFEQSEQEDSSPADRGLGPGPTGDRPPGPSKPWRTAPDLLGEAGHQQGQPASSSHHGGAGAETRSRHSSYPEGTE
DDEGTEDEELSPFRGRSSSAPPILWAAQRYGRELRRMSDEFQGSFKGLPRPKSAGTATQMRQSPSWKRFLQSWWDRNLGR
GGSAPSQ
© 1998-2022Legal notice