Dataset for protein Noxa of organism Castor canadensis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C0X1Z8_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Castor canadensis GN=PMAIP1 (length=103 residues).
MPGRKARKSAQANPTRARAELEVQCADLLRRIGDKLNPPGCAAEVLALLAEMPAMKPLKSAPPSPSAPPELEAECVQLRR
IGDKVNIRQKLLNLISKLFNLIT
© 1998-2023Legal notice