Dataset for protein Hrk of organism Castor canadensis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C0VZJ8_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Castor canadensis GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSPRTPAPRALPRYWPWLCAAAQVAA
LAAWLLGRRNL
© 1998-2023Legal notice