Dataset for protein Bik of organism Castor canadensis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C0WE14_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Castor canadensis GN=BIK (length=187 residues).
MPKCLLWENCWESPSGPHCIVPGVESHTLPVSPREEMSEARPITRDLFIETLLYEQLPGPPLAAGVSSMTESLGTLDLIH
CLEGSNQMALRLASIGDEMDLRLRSPRLAQLPGMAMHSLALTYSQTGVRGVLRNFIHGLTHLWENMRSWRLPTPSTWVFP
DQVCRQLLPSVLLAVLLLGGILHLVLQ
© 1998-2023Legal notice