Dataset for protein Puma of organism Castor canadensis

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A250YBU3_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Castor canadensis GN=BBC3 (length=251 residues).
MKLSVGAARACSCQVPRVASCGWAHALFVWSLARCAQSGVCPASGPVSRNLSQAPGSAMARARQEGSSPEPVEGLARDGP
RPFPLGRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSPAQQ
HLESPVPSVPEALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQQHRPSPWRVLYNVIMGLLPLP
RGPGAPEMEPN
>gnl|bcl2dbpro|A0A250YBU3_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Castor canadensis GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSPAQQHLESPVPSVPEALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQ
QQHRPSPWRVLYNVIMGLLPLPRGPGAPEMEPN
© 1998-2020Legal notice