Dataset for protein Bad of organism Castor canadensis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C0XEE3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Castor canadensis GN=BAD (length=149 residues).
LNSSQKLPRQRAVTVRGALSGPAKLPRCGFRSAGHRGTGDSRCPRSLTLSAGAGATETRSRHSSYPAGSDEDEGVEEEPS
PFRGRSRSAPPNLWAAQRYGRELRRMSDEFDGSFKGLPRPKSAGTATQMRQSSSWTRIIQSWWDRNLGK
© 1998-2023Legal notice