Dataset for protein Hrk of organism Canis lupus dingo

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C0L0H0_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Canis lupus dingo GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLALRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPRALPTYWPWLCAAAQVAA
LAAWLLGRRNL
© 1998-2022Legal notice