Dataset for protein Bmf of organism Canis lupus dingo

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C0JZ72_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Canis lupus dingo GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVW
WQILLFLHNLALNADENRNGAGPR
>gnl|bcl2dbpro|A0A8C0JZ72_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Canis lupus dingo GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVW
WQILLFLHNLALNADENRNGAGPR
© 1998-2022Legal notice