Dataset for protein Bmf of organism Callorhinchus milii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A4W3JXA1_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Callorhinchus milii GN=BMF (length=199 residues).
MDLSDTEELDSDDEVFAQDLTAPDSGYSDNTSGTHESLTWRATRSRLRSPINSVHFCGPGCGRQVQCDKATQTPTSIPGS
DLAEPSLPGGVGAHPRRLFYGNAGYRLGSPEVFEVPRSSGLPHQGRGDGMPMELQPEDRVEVGIGRKLQQIGDQFHSSCM
ERHHRMENHVDQPFWWRLLVLLFAMIFDPEENRAMPGQR
© 1998-2020Legal notice